(data stored in ACNUC7421 zone)

EMBL: CP000690.PE127

CP000690.PE127       Location/Qualifiers
FT   CDS             complement(139958..140659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3425"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3425"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29031"
FT                   /db_xref="GOA:A5FTU9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU9"
FT                   /protein_id="ABQ29031.1"
FT                   /translation="MKAFDWQLQKNGYIPMSGQIVDASLVSAPKQRNTEVEKEAIKAGK
FT                   TGREIWPNEPNKAAQKDMDARWTLKMGGKIRYRSDGTSLPQIALPVFGYKSHIAVDRRF
FT                   GFIRESALTSAVQADGRMLPRLVTTGNTSSGVWADSAYRSQKNETGLALRMLVSRIHRR
FT                   KPAGKPMPHNIVRANAAKSAIRAHVEHVFAHQKNRFGLFIRTIGIARAMAKLILANIAY
FT                   NFDRLVFHQRA"
     MKAFDWQLQK NGYIPMSGQI VDASLVSAPK QRNTEVEKEA IKAGKTGREI WPNEPNKAAQ        60
     KDMDARWTLK MGGKIRYRSD GTSLPQIALP VFGYKSHIAV DRRFGFIRES ALTSAVQADG       120
     RMLPRLVTTG NTSSGVWADS AYRSQKNETG LALRMLVSRI HRRKPAGKPM PHNIVRANAA       180
     KSAIRAHVEH VFAHQKNRFG LFIRTIGIAR AMAKLILANI AYNFDRLVFH QRA              233
//

If you have problems or comments...

PBIL Back to PBIL home page