(data stored in ACNUC7421 zone)

EMBL: CP000690.PE128

CP000690.PE128       Location/Qualifiers
FT   CDS             complement(140686..141402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3426"
FT                   /product="Arabinose efflux permease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3426"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29032"
FT                   /db_xref="GOA:A5FTV0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV0"
FT                   /protein_id="ABQ29032.1"
FT                   /translation="MTGDACAVLEQPRNPSLSLQAAFGATVRLIVQPLFAGQMIVATVA
FT                   RDFSLGGAETGLTAAASLHGYAVGLVCLVPLADIIETRRFMIRLLAAEAVALLICATAQ
FT                   SFVVLLAAAFAAGTASCAIQVLIPLIATVTPDARRGWVVGNVVSGLMLGILLSRLLPAF
FT                   ISGSWGWRPFYAFAACATAVAIGIINTTAPEHRPRSRESWLRFMIRDRLPLIRFLRFDL
FT                   GGPTPDENTIWLFGTN"
     MTGDACAVLE QPRNPSLSLQ AAFGATVRLI VQPLFAGQMI VATVARDFSL GGAETGLTAA        60
     ASLHGYAVGL VCLVPLADII ETRRFMIRLL AAEAVALLIC ATAQSFVVLL AAAFAAGTAS       120
     CAIQVLIPLI ATVTPDARRG WVVGNVVSGL MLGILLSRLL PAFISGSWGW RPFYAFAACA       180
     TAVAIGIINT TAPEHRPRSR ESWLRFMIRD RLPLIRFLRF DLGGPTPDEN TIWLFGTN         238
//

If you have problems or comments...

PBIL Back to PBIL home page