(data stored in ACNUC7421 zone)

EMBL: CP000690.PE130

CP000690.PE130       Location/Qualifiers
FT   CDS             141934..142869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3428"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3428"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29034"
FT                   /db_xref="GOA:A5FTV2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV2"
FT                   /protein_id="ABQ29034.1"
FT                   /translation="MNDYPNYWNNRVPSLSDYETFVAIVEAGSLTAASRRMNRSLQSVS
FT                   RALANIERDTGANLVRRTTRSMQPTDAGLVFYGRIKEALSDIAAAHTEAAELTREIAGT
FT                   LRIGSSTLFGPTYVVPTIAAFMRRHPAVAIQLVLEDSFQDLLKAELDLAIRIGELSDSR
FT                   AMATRVGALRRVAFAAPEYLLKHGRPKVPGDLRAHCCVIRTLTKSPQRWTFESAGKPET
FT                   IPVAACFSSDNAGACNEAVAEAVGIGIAPLWQIAGMLETGRVELILTEYEPPPTPVHVV
FT                   WPQASLLPTRTRAFIDFLAARLRSGLRALR"
     MNDYPNYWNN RVPSLSDYET FVAIVEAGSL TAASRRMNRS LQSVSRALAN IERDTGANLV        60
     RRTTRSMQPT DAGLVFYGRI KEALSDIAAA HTEAAELTRE IAGTLRIGSS TLFGPTYVVP       120
     TIAAFMRRHP AVAIQLVLED SFQDLLKAEL DLAIRIGELS DSRAMATRVG ALRRVAFAAP       180
     EYLLKHGRPK VPGDLRAHCC VIRTLTKSPQ RWTFESAGKP ETIPVAACFS SDNAGACNEA       240
     VAEAVGIGIA PLWQIAGMLE TGRVELILTE YEPPPTPVHV VWPQASLLPT RTRAFIDFLA       300
     ARLRSGLRAL R                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page