(data stored in ACNUC7421 zone)

EMBL: CP000690.PE131

CP000690.PE131       Location/Qualifiers
FT   CDS             143385..144269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3430"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; Male sterility C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3430"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29035"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV3"
FT                   /protein_id="ABQ29035.1"
FT                   /translation="MHVFVTGATGFIGAAVAADLLAAGHSVTGLARSAEKAKALAETGA
FT                   EVLMGNVNDLDLLARTCGKIDAVAHLAFNHDFTRFKENCEDDRKVIHAMGQTLVGTGKP
FT                   MVVTSGIPAAPGRASVETDSHPGSDVMPRAASEEAAHEALAAGANMGIIRLPQVHDTAH
FT                   FGLITFFAQVARQKGFVGYAGDGSNLWPATHVSDAARVYRLALERAAPGAVYHAAAEAG
FT                   VPAIEVSEALAKGMGLPVRALDDAEVEGYFGPLTHFSRFNILASSDWTREVLGWQPTGP
FT                   GLLEDLRRIEDFA"
     MHVFVTGATG FIGAAVAADL LAAGHSVTGL ARSAEKAKAL AETGAEVLMG NVNDLDLLAR        60
     TCGKIDAVAH LAFNHDFTRF KENCEDDRKV IHAMGQTLVG TGKPMVVTSG IPAAPGRASV       120
     ETDSHPGSDV MPRAASEEAA HEALAAGANM GIIRLPQVHD TAHFGLITFF AQVARQKGFV       180
     GYAGDGSNLW PATHVSDAAR VYRLALERAA PGAVYHAAAE AGVPAIEVSE ALAKGMGLPV       240
     RALDDAEVEG YFGPLTHFSR FNILASSDWT REVLGWQPTG PGLLEDLRRI EDFA             294
//

If you have problems or comments...

PBIL Back to PBIL home page