(data stored in ACNUC7421 zone)

EMBL: CP000690.PE132

CP000690.PE132       Location/Qualifiers
FT   CDS             complement(144451..144894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3431"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29036"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV4"
FT                   /protein_id="ABQ29036.1"
FT                   /translation="MRIGITRACVVADRGMISSDTIAALEALGMEYIPSVRERTSRVIR
FT                   DVVLNDMASIVPLALDRQHGDTQLWVKEVWIGKGKAAQRYIVPVNEAEAEKDRDDRQAI
FT                   VDGLQAQLKKGAGVRWEFSPGNGPPASLAFPAQCARPHRQEQP"
     MRIGITRACV VADRGMISSD TIAALEALGM EYIPSVRERT SRVIRDVVLN DMASIVPLAL        60
     DRQHGDTQLW VKEVWIGKGK AAQRYIVPVN EAEAEKDRDD RQAIVDGLQA QLKKGAGVRW       120
     EFSPGNGPPA SLAFPAQCAR PHRQEQP                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page