(data stored in ACNUC7421 zone)

EMBL: CP000690.PE133

CP000690.PE133       Location/Qualifiers
FT   CDS             complement(145475..146626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3432"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29037"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV5"
FT                   /protein_id="ABQ29037.1"
FT                   /translation="MDHPEMSAQQRLMIALERAAGAFARLDQALSMHPLRGAFLYRFRL
FT                   DAVRRQAMVDGQLIEPWHLAALLEGVRLRMDPWLSLAERGDIFDAARHALSMHQWIVEP
FT                   DFDQEGEIQVAMKAIERDVERASPLLGAAHAAHAWLAGGGRRAPLRGALIRFWQQSGLL
FT                   HLPVPITGPQALAGDLPFDRESWIPLLLHALANEAAAAQDLLRDLDRAWQVARASIGKR
FT                   RKNSRAAKAIDILAATPIISAKSLADRLGMNVANAHALLGELLEAGLVVELTHRSKRRL
FT                   FGLSGMGRMRDYVAPPRRPQPGRGRGRPRIEREMPQPAPPAELPPAPSGGVLPRLAFDF
FT                   SDLEEAMAAADAAIRETRISLDRIRQAGRPEADHQRLGVGETR"
     MDHPEMSAQQ RLMIALERAA GAFARLDQAL SMHPLRGAFL YRFRLDAVRR QAMVDGQLIE        60
     PWHLAALLEG VRLRMDPWLS LAERGDIFDA ARHALSMHQW IVEPDFDQEG EIQVAMKAIE       120
     RDVERASPLL GAAHAAHAWL AGGGRRAPLR GALIRFWQQS GLLHLPVPIT GPQALAGDLP       180
     FDRESWIPLL LHALANEAAA AQDLLRDLDR AWQVARASIG KRRKNSRAAK AIDILAATPI       240
     ISAKSLADRL GMNVANAHAL LGELLEAGLV VELTHRSKRR LFGLSGMGRM RDYVAPPRRP       300
     QPGRGRGRPR IEREMPQPAP PAELPPAPSG GVLPRLAFDF SDLEEAMAAA DAAIRETRIS       360
     LDRIRQAGRP EADHQRLGVG ETR                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page