(data stored in ACNUC7421 zone)

EMBL: CP000690.PE134

CP000690.PE134       Location/Qualifiers
FT   CDS             146712..147503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3433"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29038"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV6"
FT                   /protein_id="ABQ29038.1"
FT                   /translation="MPSFSPSRDAIEVQLATSRDLADLAYEIRYEAYRASGYIGERADG
FT                   LFSDKEDTRANAQTAVVFRDGIPSGTVRTLLLDPGSDNPDFHYIPALDMFGPEIRELLA
FT                   VRGTAARPATAIEATKLALASHAERDIAVLQALFRTVRYLVHAHDTNVVFNAVKHHHMP
FT                   FYRRLGYRKIEDPRPYPGLAVQTGLMACFREEFADTVDRVPFMSGLSVTDPTCQALLAG
FT                   HRVQIFSTGRPEARPALETPNRLGRAAPAPDPDADQEPGPG"
     MPSFSPSRDA IEVQLATSRD LADLAYEIRY EAYRASGYIG ERADGLFSDK EDTRANAQTA        60
     VVFRDGIPSG TVRTLLLDPG SDNPDFHYIP ALDMFGPEIR ELLAVRGTAA RPATAIEATK       120
     LALASHAERD IAVLQALFRT VRYLVHAHDT NVVFNAVKHH HMPFYRRLGY RKIEDPRPYP       180
     GLAVQTGLMA CFREEFADTV DRVPFMSGLS VTDPTCQALL AGHRVQIFST GRPEARPALE       240
     TPNRLGRAAP APDPDADQEP GPG                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page