(data stored in ACNUC7421 zone)

EMBL: CP000690.PE135

CP000690.PE135       Location/Qualifiers
FT   CDS             147715..148842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3434"
FT                   /product="phage integrase domain protein SAM domain
FT                   protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3434"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29039"
FT                   /db_xref="GOA:A5FTV7"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV7"
FT                   /protein_id="ABQ29039.1"
FT                   /translation="MPDDTEFAPQDRPDAPSAGSLVPSPPPLAGDGHAVRRWFSEIEDE
FT                   PVPVADGTLAGARSAASAYARRAKADNTRRAYRAAVRVWCLWCDRHGLTPLPASGADVA
FT                   AFLADERGRGVSTETLKLRRAAIRYLHRLAGCPVPTDDACVAETMAGIQRDAASRGEIR
FT                   RKKVAATATVIRRLLAPIGDTELTDLRDRALILVGFAGALRRSELAGIRIEHLTPSERG
FT                   LRLTLPQTKGSQAEAVTVALPYGDTELCPVHALERWRVAAGLQRGPLFRRIWSPPSGRK
FT                   GRERTAPPGPVIGERALTPQSVALIIQRRAMAAGFGRRDLGGHSLKRGALTTGMERGVH
FT                   PARLKRLGRHKSYDVLGEYLEFGDLFDGHPLDGVL"
     MPDDTEFAPQ DRPDAPSAGS LVPSPPPLAG DGHAVRRWFS EIEDEPVPVA DGTLAGARSA        60
     ASAYARRAKA DNTRRAYRAA VRVWCLWCDR HGLTPLPASG ADVAAFLADE RGRGVSTETL       120
     KLRRAAIRYL HRLAGCPVPT DDACVAETMA GIQRDAASRG EIRRKKVAAT ATVIRRLLAP       180
     IGDTELTDLR DRALILVGFA GALRRSELAG IRIEHLTPSE RGLRLTLPQT KGSQAEAVTV       240
     ALPYGDTELC PVHALERWRV AAGLQRGPLF RRIWSPPSGR KGRERTAPPG PVIGERALTP       300
     QSVALIIQRR AMAAGFGRRD LGGHSLKRGA LTTGMERGVH PARLKRLGRH KSYDVLGEYL       360
     EFGDLFDGHP LDGVL                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page