(data stored in ACNUC7421 zone)

EMBL: CP000690.PE136

CP000690.PE136       Location/Qualifiers
FT   CDS             complement(149342..149917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3436"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29040"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV8"
FT                   /protein_id="ABQ29040.1"
FT                   /translation="MVTTTVSKAATRTPSGPKANKPSHKAPKTSRALKVPMTSPGSPAA
FT                   KGGTDVSYLEYFYQAPMRQIEMIRRGIPALTVKRIAGDLRIEQDTLLRALNLSVATLNR
FT                   KVAQAKNLPADESERIAGIARLVGQVEAMVKESGDPEGFNAAEWLSRWLREPLPALGGQ
FT                   MPIKLLDTMAGQALVSQALSRIQSGAYA"
     MVTTTVSKAA TRTPSGPKAN KPSHKAPKTS RALKVPMTSP GSPAAKGGTD VSYLEYFYQA        60
     PMRQIEMIRR GIPALTVKRI AGDLRIEQDT LLRALNLSVA TLNRKVAQAK NLPADESERI       120
     AGIARLVGQV EAMVKESGDP EGFNAAEWLS RWLREPLPAL GGQMPIKLLD TMAGQALVSQ       180
     ALSRIQSGAY A                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page