(data stored in ACNUC7421 zone)

EMBL: CP000690.PE137

CP000690.PE137       Location/Qualifiers
FT   CDS             150068..150529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3437"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29041"
FT                   /db_xref="GOA:A5FTV9"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV9"
FT                   /protein_id="ABQ29041.1"
FT                   /translation="MAQNKPPRFIAELEVAQGHASFSIHVSVRAASAAPEDTASTHLLP
FT                   AGDPQRAILTEAISALRQTPEGARVELRTNSDYLTDGILRWRSGWERRNFQTAKGRPVA
FT                   LADVWKTLFAEVDARQVRAVLGTSTTKSREATHHAHDAISVADHAQQMS"
     MAQNKPPRFI AELEVAQGHA SFSIHVSVRA ASAAPEDTAS THLLPAGDPQ RAILTEAISA        60
     LRQTPEGARV ELRTNSDYLT DGILRWRSGW ERRNFQTAKG RPVALADVWK TLFAEVDARQ       120
     VRAVLGTSTT KSREATHHAH DAISVADHAQ QMS                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page