(data stored in ACNUC7421 zone)

EMBL: CP000690.PE138

CP000690.PE138       Location/Qualifiers
FT   CDS             150680..151297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3438"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29042"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW0"
FT                   /protein_id="ABQ29042.1"
FT                   /translation="MNSISPSPLVRNQQLVVNLFGGPCAGKSSLAAILFGRLKREHYEA
FT                   ELAVEFAKDLAFENRRDALKCQIYVLGNQYWRIQRAFSGGAQIVVTDSPCLLSCAYQTS
FT                   PGIEAAALEAHFAYPSLNLFVDRSERYSAYGRVHERDQAEQIDERIIGILNRFSIPFTR
FT                   VSIEHGEQQAVAMVLEQARRAAETIGAEPLSSFDHDNAPLPC"
     MNSISPSPLV RNQQLVVNLF GGPCAGKSSL AAILFGRLKR EHYEAELAVE FAKDLAFENR        60
     RDALKCQIYV LGNQYWRIQR AFSGGAQIVV TDSPCLLSCA YQTSPGIEAA ALEAHFAYPS       120
     LNLFVDRSER YSAYGRVHER DQAEQIDERI IGILNRFSIP FTRVSIEHGE QQAVAMVLEQ       180
     ARRAAETIGA EPLSSFDHDN APLPC                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page