(data stored in ACNUC7421 zone)

EMBL: CP000690.PE140

CP000690.PE140       Location/Qualifiers
FT   CDS             153446..154381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3440"
FT                   /product="plasmid encoded RepA protein"
FT                   /note="PFAM: plasmid encoded RepA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3440"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29044"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW2"
FT                   /protein_id="ABQ29044.1"
FT                   /translation="MINRLDQNVAQLVLDYGSERAREIVGPRYRALVDIANEVLTDERQ
FT                   QIGISYSGFCLTSLPHKRLSDSAVWQRKGHKVTLLVEPGVMRSKGRTVLYGVPFGARAR
FT                   MILLYLQTQAIRTNSREIELGRSMRTWMERMGIAIGGETTRALREQAARISACSLKFFW
FT                   EGDGAEGWTRGGIVSSGLRFKSVVDDDDQGKLWDDRVVLDETFWRALKDHPVPLQEAAI
FT                   RALAHRSLALDVYIWLAWRCHEIKGPTDISWISLDAQFNTTGRPLKYFKPLFTDALRAA
FT                   MAAYPDCRLDVEDRGITLRPSRPPVLKLMT"
     MINRLDQNVA QLVLDYGSER AREIVGPRYR ALVDIANEVL TDERQQIGIS YSGFCLTSLP        60
     HKRLSDSAVW QRKGHKVTLL VEPGVMRSKG RTVLYGVPFG ARARMILLYL QTQAIRTNSR       120
     EIELGRSMRT WMERMGIAIG GETTRALREQ AARISACSLK FFWEGDGAEG WTRGGIVSSG       180
     LRFKSVVDDD DQGKLWDDRV VLDETFWRAL KDHPVPLQEA AIRALAHRSL ALDVYIWLAW       240
     RCHEIKGPTD ISWISLDAQF NTTGRPLKYF KPLFTDALRA AMAAYPDCRL DVEDRGITLR       300
     PSRPPVLKLM T                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page