(data stored in ACNUC7421 zone)

EMBL: CP000690.PE141

CP000690.PE141       Location/Qualifiers
FT   CDS             complement(154742..155326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29045"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW3"
FT                   /protein_id="ABQ29045.1"
FT                   /translation="MRGVGFLDRHSSPSFRLLIAVGFLDRGSAPVIQAVDRLWPALRCF
FT                   GILLIFLGFSGQLGNPTPATGVSGPPPSRAIAGMWDFSTFGSHADVAGKILCWSGNPTL
FT                   GPLGSVWEAIEITNYFRLAGFMTPMVKKSHAPLVLQFRPVGNSHAMPGRVISVGKSHKF
FT                   RRRRSATRNARSGNPTFPTPARQTLQHHESI"
     MRGVGFLDRH SSPSFRLLIA VGFLDRGSAP VIQAVDRLWP ALRCFGILLI FLGFSGQLGN        60
     PTPATGVSGP PPSRAIAGMW DFSTFGSHAD VAGKILCWSG NPTLGPLGSV WEAIEITNYF       120
     RLAGFMTPMV KKSHAPLVLQ FRPVGNSHAM PGRVISVGKS HKFRRRRSAT RNARSGNPTF       180
     PTPARQTLQH HESI                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page