(data stored in ACNUC7421 zone)

EMBL: CP000690.PE142

CP000690.PE142       Location/Qualifiers
FT   CDS             complement(155465..156511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3442"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29046"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW4"
FT                   /protein_id="ABQ29046.1"
FT                   /translation="MRAARTGKESTGFFRIGEASEVGGLVLGGDYCAEHESGIEELRRE
FT                   FGISSKAPPGIERYRISGLSSRSALVFCDRPDLDQSILCCSHPSNVAQLVGKPGITGGL
FT                   ATRHEGFDLVAANRLVAFLPTWRDKDDRVRVLPVHSKAADREAWKAYNAGIIGAWSERS
FT                   FMVRALGEDARRDLEAVYNALLGCDIALSATRALTPFGRGGLAIVIASRIQPADLDRLR
FT                   EQDEDQDLLDATFKATGLPARFAERRGTDPLFGPNAKPAYFGIRPTWTREFIERRKADP
FT                   AARPTEDDLTVWLNPMEQRHHNFGWFSVDALRRWFDGEGPVVKAWVEQQRVGFPDQPAP
FT                   DGLAPGCG"
     MRAARTGKES TGFFRIGEAS EVGGLVLGGD YCAEHESGIE ELRREFGISS KAPPGIERYR        60
     ISGLSSRSAL VFCDRPDLDQ SILCCSHPSN VAQLVGKPGI TGGLATRHEG FDLVAANRLV       120
     AFLPTWRDKD DRVRVLPVHS KAADREAWKA YNAGIIGAWS ERSFMVRALG EDARRDLEAV       180
     YNALLGCDIA LSATRALTPF GRGGLAIVIA SRIQPADLDR LREQDEDQDL LDATFKATGL       240
     PARFAERRGT DPLFGPNAKP AYFGIRPTWT REFIERRKAD PAARPTEDDL TVWLNPMEQR       300
     HHNFGWFSVD ALRRWFDGEG PVVKAWVEQQ RVGFPDQPAP DGLAPGCG                    348
//

If you have problems or comments...

PBIL Back to PBIL home page