(data stored in ACNUC7421 zone)

EMBL: CP000690.PE143

CP000690.PE143       Location/Qualifiers
FT   CDS             complement(156542..159727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3443"
FT                   /product="Superfamily I DNA and RNA helicase and helicase
FT                   subunits-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3443"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29047"
FT                   /db_xref="GOA:A5FTW5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW5"
FT                   /protein_id="ABQ29047.1"
FT                   /translation="MSTTQRRRPPTQFIGATDDDVPEVAEIVAESRKAEIGTGQPIRVA
FT                   GSQHAAPAAPAGQPAQDDESVLTVLPAQPANPAEQPVELSPSQKKGLAVLDAWIAAEVL
FT                   TPETVKDLKDIVSGRERDMAALDLVYGDALPWEEGYPETEFPNLRAGYLAYDVIFGSIP
FT                   EAKAAVRLEEVYGQSFGDGGAGSGVSILATLRVAPNGTLDLKDGVSPFSVSAYGWGLVR
FT                   ALNRDLGAMPGWKHAAADISKSFRDLFDDRFKDKPIDKAAILEIYYWMLDSLGFDEKLV
FT                   SRPSRESDVVSKPAKVIGYYQRVSPDGTPVPKQRMPDALIMNSFFLSDLLDARRDLAKG
FT                   IEQPLLDRYLGVKEQVRRINILEDPKAINTLLRPGLFPEGKWPHAGRNQLVAMQQSIIN
FT                   YALHPAQVRRNKVIGVNGPPGTGKTTLLKDAAAALIVRRAIAMSDFIHPSHAFRVFGSG
FT                   GARSSGRADPSLFELDPKLIGFEMLVASSNNGAVENVSTEWPDNGAIADDATTRYYPGT
FT                   ASRLHERESWGLVSAALGNSANRAKFRDQFWFDEDWGLRNQLALAAGRSPVIVDKKTGA
FT                   KRIPASFEAHRPARGRHAALERWNRERDRFLQLLDTVRKSLSDVNKAATGELDQSDPFH
FT                   FHTSSPWLSGADHRQREDLFEAAIDLHRAFMEGAATEVGSNLSAAMELLAGRFNGRKPK
FT                   VVQSVLSTLFIAVPVLSTTFASVRRMLRDVEEPMIGWLFIDEAGQATPQSAVGAIKRSR
FT                   NALVVGDPIQVEPVVTLNEPMVVEIAKAMGIDHEVDMAPWGSVQTFADGASEVFAEYPC
FT                   EGGARRVGMPLLAHRRCAEPMFSISNQIGYGGLMVNAKRPSPSAIRDACGPSRWIDVHD
FT                   PVDEKWSEQEGMVVFNLLRDIVARGGKLDLYIISPFRIIESRLRDMVIQNHAGIGISFA
FT                   EARELTRRIGTVHKVQGREAEGVIFVLGHQGEAFKRARGWAGGRPNIANVAVTRAKEVL
FT                   YIVGNRADWSEAGYFHTVEQVMDEFTRQHGVAAGDALAVPPAPIREEQTEAPAPVLEDH
FT                   ESIFDLDLGLGLG"
     MSTTQRRRPP TQFIGATDDD VPEVAEIVAE SRKAEIGTGQ PIRVAGSQHA APAAPAGQPA        60
     QDDESVLTVL PAQPANPAEQ PVELSPSQKK GLAVLDAWIA AEVLTPETVK DLKDIVSGRE       120
     RDMAALDLVY GDALPWEEGY PETEFPNLRA GYLAYDVIFG SIPEAKAAVR LEEVYGQSFG       180
     DGGAGSGVSI LATLRVAPNG TLDLKDGVSP FSVSAYGWGL VRALNRDLGA MPGWKHAAAD       240
     ISKSFRDLFD DRFKDKPIDK AAILEIYYWM LDSLGFDEKL VSRPSRESDV VSKPAKVIGY       300
     YQRVSPDGTP VPKQRMPDAL IMNSFFLSDL LDARRDLAKG IEQPLLDRYL GVKEQVRRIN       360
     ILEDPKAINT LLRPGLFPEG KWPHAGRNQL VAMQQSIINY ALHPAQVRRN KVIGVNGPPG       420
     TGKTTLLKDA AAALIVRRAI AMSDFIHPSH AFRVFGSGGA RSSGRADPSL FELDPKLIGF       480
     EMLVASSNNG AVENVSTEWP DNGAIADDAT TRYYPGTASR LHERESWGLV SAALGNSANR       540
     AKFRDQFWFD EDWGLRNQLA LAAGRSPVIV DKKTGAKRIP ASFEAHRPAR GRHAALERWN       600
     RERDRFLQLL DTVRKSLSDV NKAATGELDQ SDPFHFHTSS PWLSGADHRQ REDLFEAAID       660
     LHRAFMEGAA TEVGSNLSAA MELLAGRFNG RKPKVVQSVL STLFIAVPVL STTFASVRRM       720
     LRDVEEPMIG WLFIDEAGQA TPQSAVGAIK RSRNALVVGD PIQVEPVVTL NEPMVVEIAK       780
     AMGIDHEVDM APWGSVQTFA DGASEVFAEY PCEGGARRVG MPLLAHRRCA EPMFSISNQI       840
     GYGGLMVNAK RPSPSAIRDA CGPSRWIDVH DPVDEKWSEQ EGMVVFNLLR DIVARGGKLD       900
     LYIISPFRII ESRLRDMVIQ NHAGIGISFA EARELTRRIG TVHKVQGREA EGVIFVLGHQ       960
     GEAFKRARGW AGGRPNIANV AVTRAKEVLY IVGNRADWSE AGYFHTVEQV MDEFTRQHGV      1020
     AAGDALAVPP APIREEQTEA PAPVLEDHES IFDLDLGLGL G                          1061
//

If you have problems or comments...

PBIL Back to PBIL home page