(data stored in ACNUC7421 zone)

EMBL: CP000690.PE144

CP000690.PE144       Location/Qualifiers
FT   CDS             159926..160303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3444"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29048"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW6"
FT                   /protein_id="ABQ29048.1"
FT                   /translation="MSSNSDQKIDFSATFGLSKSVPAMIEARDHLGRHFPTRPWEDILL
FT                   GAVQPPAPIEVVHYSTGAVAIFWTRGASIVCLLYQGDGCVFHGQGSDGRDCARLGTMSY
FT                   VEEVLPRSVMLEILAVCRQKG"
     MSSNSDQKID FSATFGLSKS VPAMIEARDH LGRHFPTRPW EDILLGAVQP PAPIEVVHYS        60
     TGAVAIFWTR GASIVCLLYQ GDGCVFHGQG SDGRDCARLG TMSYVEEVLP RSVMLEILAV       120
     CRQKG                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page