(data stored in ACNUC7421 zone)

EMBL: CP000690.PE145

CP000690.PE145       Location/Qualifiers
FT   CDS             160447..161007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29049"
FT                   /db_xref="InterPro:IPR025433"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW7"
FT                   /protein_id="ABQ29049.1"
FT                   /translation="MNSRTIITSSALIMMLAAGSALAQTSAGGQAGVGASVGVGANAGA
FT                   GGLVGSTLGAARSTAGNVGSAVGSTAAGVTSKVGAQANGMARSAEATSADFSAATISKA
FT                   RLATRQISVLEAREHREIRTAKTASRRRAIETRARAERARLIKSHGLSVSEYDRIVSEA
FT                   RSNPSLASRIGLSVSAGAGAQMK"
     MNSRTIITSS ALIMMLAAGS ALAQTSAGGQ AGVGASVGVG ANAGAGGLVG STLGAARSTA        60
     GNVGSAVGST AAGVTSKVGA QANGMARSAE ATSADFSAAT ISKARLATRQ ISVLEAREHR       120
     EIRTAKTASR RRAIETRARA ERARLIKSHG LSVSEYDRIV SEARSNPSLA SRIGLSVSAG       180
     AGAQMK                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page