(data stored in ACNUC7421 zone)

EMBL: CP000690.PE146

CP000690.PE146       Location/Qualifiers
FT   CDS             complement(161163..163016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3446"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29050"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW8"
FT                   /protein_id="ABQ29050.1"
FT                   /translation="MAIHLVGETIDAKRAHHRAQSGDLIPLVRGVYVDHDGDAETAILA
FT                   HAVRIAHYLYPNAYLSSASAVLLAPTPDGRLFISGRRNQRTRLRALEIIQNEAPAHPST
FT                   AIAVIGDDLGELRIAASSPRQRFLEAFRLRSEHASAITAEMRAQMAARLVAEHGTPQAA
FT                   ADAVWALARENEWYREGEGAERFLLAKPGGAAPVNKAALNLLVAWHGDLVGRLTHDGFE
FT                   WRWKPERRTGPALIRGTTPGKLPAFIESLLPEGWLAQVLHERDERDALRRGRRYMSNIA
FT                   IVEDRDQLATLPADVLSTPLSSFAADGRFTGVYAGPGRGEIEDTFEQNLARIFARSETP
FT                   RLSGVQIKAPMSLTKDGSLVPAIDQPFTHILKPTGAAGFDMLPIVEWLCLELGRAAGFE
FT                   TPDAALIAMPDGMPPSLVVERFDIRRGPHDLRRLAMEDFCSVLDLPTSAKYDGTIERMA
FT                   RALRPLSTDPAADLNILFRRAVFAWLIADGDMHLKNLAVLKTADVGAKTFTTVRFAPLY
FT                   DAVTTRVFPSLAGDRMALKLNGKDDRLTRQDFLRLARTIGLTVEDAEAALEALTTRITE
FT                   RLVTLQLPAFAVEFADAKAVRDKVEAIATARCLALRRRGQP"
     MAIHLVGETI DAKRAHHRAQ SGDLIPLVRG VYVDHDGDAE TAILAHAVRI AHYLYPNAYL        60
     SSASAVLLAP TPDGRLFISG RRNQRTRLRA LEIIQNEAPA HPSTAIAVIG DDLGELRIAA       120
     SSPRQRFLEA FRLRSEHASA ITAEMRAQMA ARLVAEHGTP QAAADAVWAL ARENEWYREG       180
     EGAERFLLAK PGGAAPVNKA ALNLLVAWHG DLVGRLTHDG FEWRWKPERR TGPALIRGTT       240
     PGKLPAFIES LLPEGWLAQV LHERDERDAL RRGRRYMSNI AIVEDRDQLA TLPADVLSTP       300
     LSSFAADGRF TGVYAGPGRG EIEDTFEQNL ARIFARSETP RLSGVQIKAP MSLTKDGSLV       360
     PAIDQPFTHI LKPTGAAGFD MLPIVEWLCL ELGRAAGFET PDAALIAMPD GMPPSLVVER       420
     FDIRRGPHDL RRLAMEDFCS VLDLPTSAKY DGTIERMARA LRPLSTDPAA DLNILFRRAV       480
     FAWLIADGDM HLKNLAVLKT ADVGAKTFTT VRFAPLYDAV TTRVFPSLAG DRMALKLNGK       540
     DDRLTRQDFL RLARTIGLTV EDAEAALEAL TTRITERLVT LQLPAFAVEF ADAKAVRDKV       600
     EAIATARCLA LRRRGQP                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page