(data stored in ACNUC7421 zone)

EMBL: CP000690.PE147

CP000690.PE147       Location/Qualifiers
FT   CDS             complement(163196..164137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3447"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29051"
FT                   /db_xref="InterPro:IPR031618"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW9"
FT                   /protein_id="ABQ29051.1"
FT                   /translation="MARIRFRSAALPAAVILLGLTGCANLQGAPGKAASAKPVPPDMVG
FT                   IHINDGDSMFPVQTGDAARQAIPSLKAMSRMHRDGSGTSKEAAKEMVELPVIRDTALRY
FT                   GAEGGVAWATRIIDGELRANAARLSQIYDFSRLVTYQPGGVQILPPVISESRNLYQSSD
FT                   FGRTIRVADTYYDIVRQARFVPSAPLWYGYLYRTWQAPHRPFEAGLPHNSEEEAVWKHY
FT                   VKAGWRAGVQEGETIFRLDLDRLNRDFTGMIRYRKLNDEGKVSAPVVQAKTLGVTGTGQ
FT                   NMREGDRVVKIIAEPSLSVPHPRTSPIKATPN"
     MARIRFRSAA LPAAVILLGL TGCANLQGAP GKAASAKPVP PDMVGIHIND GDSMFPVQTG        60
     DAARQAIPSL KAMSRMHRDG SGTSKEAAKE MVELPVIRDT ALRYGAEGGV AWATRIIDGE       120
     LRANAARLSQ IYDFSRLVTY QPGGVQILPP VISESRNLYQ SSDFGRTIRV ADTYYDIVRQ       180
     ARFVPSAPLW YGYLYRTWQA PHRPFEAGLP HNSEEEAVWK HYVKAGWRAG VQEGETIFRL       240
     DLDRLNRDFT GMIRYRKLND EGKVSAPVVQ AKTLGVTGTG QNMREGDRVV KIIAEPSLSV       300
     PHPRTSPIKA TPN                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page