(data stored in ACNUC7421 zone)

EMBL: CP000690.PE148

CP000690.PE148       Location/Qualifiers
FT   CDS             complement(164140..164691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3448"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29052"
FT                   /db_xref="InterPro:IPR031817"
FT                   /db_xref="InterPro:IPR038140"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX0"
FT                   /protein_id="ABQ29052.1"
FT                   /translation="MVRIRSKAVLAVLALVAGMPALAHADVMTTEAQAVQAEAESNLAR
FT                   AFTEASQALSQLDNGPVDPQQVATPKGVAIAAPAAPVQAALPKIDLARLPAQLRRPVTI
FT                   RWNGPVEGAIRKLAAQINYTVLPPTHTPATPPTIVLVKNKVPAAIVLQDIGARIRTYGK
FT                   LVVSPAARTIQFDVNQAAGT"
     MVRIRSKAVL AVLALVAGMP ALAHADVMTT EAQAVQAEAE SNLARAFTEA SQALSQLDNG        60
     PVDPQQVATP KGVAIAAPAA PVQAALPKID LARLPAQLRR PVTIRWNGPV EGAIRKLAAQ       120
     INYTVLPPTH TPATPPTIVL VKNKVPAAIV LQDIGARIRT YGKLVVSPAA RTIQFDVNQA       180
     AGT                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page