(data stored in ACNUC7421 zone)

EMBL: CP000690.PE149

CP000690.PE149       Location/Qualifiers
FT   CDS             complement(165544..166482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3449"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29053"
FT                   /db_xref="GOA:A5FTX1"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX1"
FT                   /protein_id="ABQ29053.1"
FT                   /translation="MPDDALDAPDDEHIDPLDFVRWLIGLRPTLSSSTWRSYKAASAFY
FT                   LYDSMHPSARAAAAILDGVSADDGEVAASEGVKGTKFFRLEDYNKLLQFCLDRGRGESA
FT                   RTMFHFARAAIRTGMRPSEWATCDMRTSKNPDAPFGRNVWLFVCNAKASNGRANGLVRV
FT                   LDLSPLSRIDIEPIRYTMALFQRQAAKEGTEPTIRRLRQSINHIGAATGMSAKYSPYSF
FT                   RHQAIANWKTIYSPVEVAALAGHSVPETATEHYGRKRDGWTGKGTGGIMIRPSRVDVER
FT                   IMSRIRSDNPAPFMRPDGSLAVVPEDMPTPQ"
     MPDDALDAPD DEHIDPLDFV RWLIGLRPTL SSSTWRSYKA ASAFYLYDSM HPSARAAAAI        60
     LDGVSADDGE VAASEGVKGT KFFRLEDYNK LLQFCLDRGR GESARTMFHF ARAAIRTGMR       120
     PSEWATCDMR TSKNPDAPFG RNVWLFVCNA KASNGRANGL VRVLDLSPLS RIDIEPIRYT       180
     MALFQRQAAK EGTEPTIRRL RQSINHIGAA TGMSAKYSPY SFRHQAIANW KTIYSPVEVA       240
     ALAGHSVPET ATEHYGRKRD GWTGKGTGGI MIRPSRVDVE RIMSRIRSDN PAPFMRPDGS       300
     LAVVPEDMPT PQ                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page