(data stored in ACNUC7421 zone)

EMBL: CP000690.PE15

CP000690.PE15        Location/Qualifiers
FT   CDS             complement(19016..20407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3307"
FT                   /product="replication protein C"
FT                   /note="PFAM: replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28919"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI7"
FT                   /protein_id="ABQ28919.1"
FT                   /translation="MENFRPESGPGPKLRGVRGARRLTLGMVATERLADDFGTLSEGGQ
FT                   VDPGRVLAAFKAAAPYLRFGPRVTQAIDWLFRFTQVQDWQEGARPIVWPSAAMQMEALC
FT                   LSEAQVKRLNRLLAHLGLITMRDSPNGKRYGRRDPRGRIVEAYGFDLSPIAVRQAEFRE
FT                   IAERGRARFEALKQLRRRATIAVRGIQQIVETAAELGIAEGWVRQADEARRLVARIRRI
FT                   EELDEVTLGVTTLENRQADLRGRLEAAMGALKEAGQAPVESTNMSPKGLTDEPHITHTN
FT                   QTLDPTDHVSASRKRNSTSGGAGTSAGGSTRTGRNGDGKEAGHRPTGSRATKPEIPPDG
FT                   TVFRMTPDELVRLAPRLRAYLAKSSPGWPEIVEAADWLRHDLGVSKPLWGDACLAMGRE
FT                   QAAVALAIVSTKPSDHFRGSPGGYFHGMVARARAGELNLARSIWGIRAASGMPRPASAS
FT                   GVGAV"
     MENFRPESGP GPKLRGVRGA RRLTLGMVAT ERLADDFGTL SEGGQVDPGR VLAAFKAAAP        60
     YLRFGPRVTQ AIDWLFRFTQ VQDWQEGARP IVWPSAAMQM EALCLSEAQV KRLNRLLAHL       120
     GLITMRDSPN GKRYGRRDPR GRIVEAYGFD LSPIAVRQAE FREIAERGRA RFEALKQLRR       180
     RATIAVRGIQ QIVETAAELG IAEGWVRQAD EARRLVARIR RIEELDEVTL GVTTLENRQA       240
     DLRGRLEAAM GALKEAGQAP VESTNMSPKG LTDEPHITHT NQTLDPTDHV SASRKRNSTS       300
     GGAGTSAGGS TRTGRNGDGK EAGHRPTGSR ATKPEIPPDG TVFRMTPDEL VRLAPRLRAY       360
     LAKSSPGWPE IVEAADWLRH DLGVSKPLWG DACLAMGREQ AAVALAIVST KPSDHFRGSP       420
     GGYFHGMVAR ARAGELNLAR SIWGIRAASG MPRPASASGV GAV                         463
//

If you have problems or comments...

PBIL Back to PBIL home page