(data stored in ACNUC7421 zone)

EMBL: CP000690.PE150

CP000690.PE150       Location/Qualifiers
FT   CDS             167207..167761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3450"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29054"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX2"
FT                   /protein_id="ABQ29054.1"
FT                   /translation="MTATAAIPVDRPSYHEGKRLYRRLVAGDLSHLAPVLASLQPLVGA
FT                   AAAGLAARLIEAGVDADELLVRAALAHHVRRPGYLERMAAPDSMRHDLDGNPVEPVSAR
FT                   HRDHAAATRKAMGPSLAKARQQARRRTEREARSRWRATPAPVVEVKQAGRRRLAAPAGA
FT                   GQGAVASLRDRLGIAARLSLG"
     MTATAAIPVD RPSYHEGKRL YRRLVAGDLS HLAPVLASLQ PLVGAAAAGL AARLIEAGVD        60
     ADELLVRAAL AHHVRRPGYL ERMAAPDSMR HDLDGNPVEP VSARHRDHAA ATRKAMGPSL       120
     AKARQQARRR TEREARSRWR ATPAPVVEVK QAGRRRLAAP AGAGQGAVAS LRDRLGIAAR       180
     LSLG                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page