(data stored in ACNUC7421 zone)

EMBL: CP000690.PE151

CP000690.PE151       Location/Qualifiers
FT   CDS             complement(167766..168089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3451"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29055"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX3"
FT                   /protein_id="ABQ29055.1"
FT                   /translation="MAAESAALTPAEASASLAALSQQLAGKFVVSQPSERTARKAVDTL
FT                   QSAAPGSFWIAFSRQELKLLWLAITNGAPEYGNALGMTPREVEMFGRAANRIGRAAGEE
FT                   VLF"
     MAAESAALTP AEASASLAAL SQQLAGKFVV SQPSERTARK AVDTLQSAAP GSFWIAFSRQ        60
     ELKLLWLAIT NGAPEYGNAL GMTPREVEMF GRAANRIGRA AGEEVLF                     107
//

If you have problems or comments...

PBIL Back to PBIL home page