(data stored in ACNUC7421 zone)

EMBL: CP000690.PE152

CP000690.PE152       Location/Qualifiers
FT   CDS             168288..168647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3452"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3452"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29056"
FT                   /db_xref="GOA:A5FTX4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX4"
FT                   /protein_id="ABQ29056.1"
FT                   /translation="MIAPTRPADLIWRSTTMPKLSPLSREEMMRLRTQLADDVEAGGLP
FT                   LSLAVRRMRKAIGFTQVQFAKAMRLTTRQIWEIENGKANPSLETMNKLAHPFGFRVGFI
FT                   SRHRAAAMEEADRAP"
     MIAPTRPADL IWRSTTMPKL SPLSREEMMR LRTQLADDVE AGGLPLSLAV RRMRKAIGFT        60
     QVQFAKAMRL TTRQIWEIEN GKANPSLETM NKLAHPFGFR VGFISRHRAA AMEEADRAP        119
//

If you have problems or comments...

PBIL Back to PBIL home page