(data stored in ACNUC7421 zone)

EMBL: CP000690.PE153

CP000690.PE153       Location/Qualifiers
FT   CDS             complement(168714..169349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3453"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3453"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX5"
FT                   /protein_id="ABQ29057.1"
FT                   /translation="MLAAKVGRIIVAAGTNGAGKSSIVGPLIRSLGGAYYNPDEQARSF
FT                   MAIGLGTEQANARAWGLGYEGLQRAIDQNLNFAFETTLGGASITMELLRALALERRVLI
FT                   FYVGLASVDLHIQRVAERVARGGHDIPERKIRERYDNSRTNLLKFIGTRAEMRVWDNSH
FT                   QSADGSPAPREVFRVQNREMLIPKGGELSATVAWAQPLVAKALSISPG"
     MLAAKVGRII VAAGTNGAGK SSIVGPLIRS LGGAYYNPDE QARSFMAIGL GTEQANARAW        60
     GLGYEGLQRA IDQNLNFAFE TTLGGASITM ELLRALALER RVLIFYVGLA SVDLHIQRVA       120
     ERVARGGHDI PERKIRERYD NSRTNLLKFI GTRAEMRVWD NSHQSADGSP APREVFRVQN       180
     REMLIPKGGE LSATVAWAQP LVAKALSISP G                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page