(data stored in ACNUC7421 zone)

EMBL: CP000690.PE154

CP000690.PE154       Location/Qualifiers
FT   CDS             complement(169336..169698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3454"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3454"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29058"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX6"
FT                   /protein_id="ABQ29058.1"
FT                   /translation="MSKSAVIEASAARSSFAKLGEQARRAPVEVTRHGKLEFVVISPDL
FT                   YEAVKAAGTVPVGELARMQESFNQMFQDMQSDRSEAAYERLEALTAEDLPKAAVDAYRR
FT                   TRRRAPGHRSGSGVGR"
     MSKSAVIEAS AARSSFAKLG EQARRAPVEV TRHGKLEFVV ISPDLYEAVK AAGTVPVGEL        60
     ARMQESFNQM FQDMQSDRSE AAYERLEALT AEDLPKAAVD AYRRTRRRAP GHRSGSGVGR       120
//

If you have problems or comments...

PBIL Back to PBIL home page