(data stored in ACNUC7421 zone)

EMBL: CP000690.PE156

CP000690.PE156       Location/Qualifiers
FT   CDS             complement(170868..171578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3456"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3456"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29060"
FT                   /db_xref="GOA:A5FTX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX8"
FT                   /protein_id="ABQ29060.1"
FT                   /translation="MSAVLEAEGLQTYYGKSHILHGVSLKVNQGELIALLGRNGAGKTT
FT                   TMRSVMGLTPPRDGNVKLFGKDVTKAASHRIANAGVGYVPEGRKIFGHMTVHENLLVPP
FT                   ETKGPWTIETIYKLFPRLEERKTSKGGRLSGGEQEMLAIARALLLNPKFLILDEPSQGL
FT                   APVIVQEVMRTIGRMKGEGMSILLVEQNAHLALQLADRAYVLSDGEVVYDGSAAELGAD
FT                   TERMEHLAGVSHVD"
     MSAVLEAEGL QTYYGKSHIL HGVSLKVNQG ELIALLGRNG AGKTTTMRSV MGLTPPRDGN        60
     VKLFGKDVTK AASHRIANAG VGYVPEGRKI FGHMTVHENL LVPPETKGPW TIETIYKLFP       120
     RLEERKTSKG GRLSGGEQEM LAIARALLLN PKFLILDEPS QGLAPVIVQE VMRTIGRMKG       180
     EGMSILLVEQ NAHLALQLAD RAYVLSDGEV VYDGSAAELG ADTERMEHLA GVSHVD           236
//

If you have problems or comments...

PBIL Back to PBIL home page