(data stored in ACNUC7421 zone)

EMBL: CP000690.PE157

CP000690.PE157       Location/Qualifiers
FT   CDS             complement(171575..172339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3457"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29061"
FT                   /db_xref="GOA:A5FTX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX9"
FT                   /protein_id="ABQ29061.1"
FT                   /translation="MSLLKLEHVGRRFGALQALKDISLAVEPGELRAIIGPNGAGKTTL
FT                   FNLISGFFPPTEGQIIFDGQPITAVSPNDLVRRGIIRTFQITQVFLSLSVYENIRVAVE
FT                   TAMGLQLRPWISRAARAKVDEKVDELLQVTRIANKADRIVGEMSHGDQRVVEIGIALSR
FT                   HPRLLLLDEPTAGMGDEETHHMTDLIRRLNKDQGITMLFVEHDMAIVFGIADRITVLDN
FT                   GTFLAEGTAAEISANPRVQSAYLGTAIEETAA"
     MSLLKLEHVG RRFGALQALK DISLAVEPGE LRAIIGPNGA GKTTLFNLIS GFFPPTEGQI        60
     IFDGQPITAV SPNDLVRRGI IRTFQITQVF LSLSVYENIR VAVETAMGLQ LRPWISRAAR       120
     AKVDEKVDEL LQVTRIANKA DRIVGEMSHG DQRVVEIGIA LSRHPRLLLL DEPTAGMGDE       180
     ETHHMTDLIR RLNKDQGITM LFVEHDMAIV FGIADRITVL DNGTFLAEGT AAEISANPRV       240
     QSAYLGTAIE ETAA                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page