(data stored in ACNUC7421 zone)

EMBL: CP000690.PE158

CP000690.PE158       Location/Qualifiers
FT   CDS             complement(172336..173322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3458"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3458"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29062"
FT                   /db_xref="GOA:A5FTY0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY0"
FT                   /protein_id="ABQ29062.1"
FT                   /translation="MSTALDTKPATRPAPSIGGREISAAIIWLALLFVPIWLPAIGGFT
FT                   DLASRVLVYAMAATGLNLLLGYTGGLSFGHAAYFGLGAYGTGLFIIHVIPSMPLALIAG
FT                   TLLGGIGGILVGPMVMKRKGIYFAMITIAFGQMFYFLAVRWNTVTGGEDGLTGFSRVPL
FT                   HLGGEAINLGPARFYYVVLALFAVVMLVVWQILRSPMGHAFVATRENTTRLRFLGVAVD
FT                   KQVWVAFAISAFITALAGSLNAMLTAFASPDDLQWQLSGSFVVICVLGGMRSFWGPFLG
FT                   AVIYIAAQDYLSSVTQNWMSFIGLIFVLSVLFFPQGLLGFIKGRARS"
     MSTALDTKPA TRPAPSIGGR EISAAIIWLA LLFVPIWLPA IGGFTDLASR VLVYAMAATG        60
     LNLLLGYTGG LSFGHAAYFG LGAYGTGLFI IHVIPSMPLA LIAGTLLGGI GGILVGPMVM       120
     KRKGIYFAMI TIAFGQMFYF LAVRWNTVTG GEDGLTGFSR VPLHLGGEAI NLGPARFYYV       180
     VLALFAVVML VVWQILRSPM GHAFVATREN TTRLRFLGVA VDKQVWVAFA ISAFITALAG       240
     SLNAMLTAFA SPDDLQWQLS GSFVVICVLG GMRSFWGPFL GAVIYIAAQD YLSSVTQNWM       300
     SFIGLIFVLS VLFFPQGLLG FIKGRARS                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page