(data stored in ACNUC7421 zone)

EMBL: CP000690.PE159

CP000690.PE159       Location/Qualifiers
FT   CDS             complement(173319..174188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3459"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3459"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29063"
FT                   /db_xref="GOA:A5FTY1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY1"
FT                   /protein_id="ABQ29063.1"
FT                   /translation="METLLVYSAFNGLVVGIFYALMALGLSLILGLNGIINFAHGTFMA
FT                   LGGYLAFTLEPYIGFWGGLLVAPLLAVVVGVVTERVLIRPLYGRDPLFSLLLTFGLAMI
FT                   MQDMIRTIWGSIGQPFALPNYLNSPLSSSMFFLTGFRIVVILITVLVTGALFAVLRFSR
FT                   IGIRIRAGNADLETISSLGVNIFFLRAVNFGIGIFLAGVAGILAAGQLGLSPTIGDSLI
FT                   MPAFVAIIVGGVGSLMGSVLGGLIIGIASGLTAAFYPVAQEVVIYVIMAVVLVIRPRGL
FT                   LGQEGLFE"
     METLLVYSAF NGLVVGIFYA LMALGLSLIL GLNGIINFAH GTFMALGGYL AFTLEPYIGF        60
     WGGLLVAPLL AVVVGVVTER VLIRPLYGRD PLFSLLLTFG LAMIMQDMIR TIWGSIGQPF       120
     ALPNYLNSPL SSSMFFLTGF RIVVILITVL VTGALFAVLR FSRIGIRIRA GNADLETISS       180
     LGVNIFFLRA VNFGIGIFLA GVAGILAAGQ LGLSPTIGDS LIMPAFVAII VGGVGSLMGS       240
     VLGGLIIGIA SGLTAAFYPV AQEVVIYVIM AVVLVIRPRG LLGQEGLFE                   289
//

If you have problems or comments...

PBIL Back to PBIL home page