(data stored in ACNUC7421 zone)

EMBL: CP000690.PE16

CP000690.PE16        Location/Qualifiers
FT   CDS             complement(21035..21919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3308"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28920"
FT                   /db_xref="GOA:A5FTI8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI8"
FT                   /protein_id="ABQ28920.1"
FT                   /translation="MIWEVAVDASDLKMFEAVARLGSMKRAAAELNTVQSNVTARIKAL
FT                   ENDLGISLFQRHARGVTITGPGQRMLPFAGQITKLLADARAAAKDDGTPNGPLKIGSLE
FT                   TTTAMRLAPLLSNFTLAYPEVQLVVTTGTTAQLVTELLEYRLDGAFVAGPVEHPDLDRQ
FT                   VVFIEELVLVTSPSVTDPSSLTKCGTLRTIVFQYGCSYRQKLEAVLSGMGIANARPLEL
FT                   GSLDAMIACVSAGVGVTLLPRRVVAHAASEGNVSAHALPQIHANVETLFIRRKDTYVSS
FT                   AMRAFLELCDTQT"
     MIWEVAVDAS DLKMFEAVAR LGSMKRAAAE LNTVQSNVTA RIKALENDLG ISLFQRHARG        60
     VTITGPGQRM LPFAGQITKL LADARAAAKD DGTPNGPLKI GSLETTTAMR LAPLLSNFTL       120
     AYPEVQLVVT TGTTAQLVTE LLEYRLDGAF VAGPVEHPDL DRQVVFIEEL VLVTSPSVTD       180
     PSSLTKCGTL RTIVFQYGCS YRQKLEAVLS GMGIANARPL ELGSLDAMIA CVSAGVGVTL       240
     LPRRVVAHAA SEGNVSAHAL PQIHANVETL FIRRKDTYVS SAMRAFLELC DTQT             294
//

If you have problems or comments...

PBIL Back to PBIL home page