(data stored in ACNUC7421 zone)

EMBL: CP000690.PE160

CP000690.PE160       Location/Qualifiers
FT   CDS             complement(174309..175562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3460"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3460"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29064"
FT                   /db_xref="GOA:A5FTY2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY2"
FT                   /protein_id="ABQ29064.1"
FT                   /translation="MKSLNPGSLDRRGLLKAAGATGASSLILPNISWAASEKPVKIGMI
FT                   DPRTGTYAAAGFSEIHGATMAIDEINKKGGILGRPVQMFVEDSESLPGPGVTKAQKLVA
FT                   EDKVNFLMGAVNSATAESLSQFALQHNMLYIDTGGHVDDVTGSKCHWTTFRTCSTTWML
FT                   TAGDFETLFKKFGKKWFFITPDYAFGHAEHRDYVKQLQKAGGKSVGNALAPLGTTDFSS
FT                   YLIRARAAKPDVLICLQAGDDLVNLLKQAVQFGLDKQMAIAGALQEMEVLESLPKAALL
FT                   GWWTFEWYWNQPGVPHVADFVTAYKRRFGDKVPTARSWFGYVSAHSIALAANQAKTLDS
FT                   LKVVKALEGMELPPEIALQPGKVHYRAGDHQMMANMFPGYVPKDASYPNLFKVADVVPS
FT                   EKIALSPAAAGCKMTYPS"
     MKSLNPGSLD RRGLLKAAGA TGASSLILPN ISWAASEKPV KIGMIDPRTG TYAAAGFSEI        60
     HGATMAIDEI NKKGGILGRP VQMFVEDSES LPGPGVTKAQ KLVAEDKVNF LMGAVNSATA       120
     ESLSQFALQH NMLYIDTGGH VDDVTGSKCH WTTFRTCSTT WMLTAGDFET LFKKFGKKWF       180
     FITPDYAFGH AEHRDYVKQL QKAGGKSVGN ALAPLGTTDF SSYLIRARAA KPDVLICLQA       240
     GDDLVNLLKQ AVQFGLDKQM AIAGALQEME VLESLPKAAL LGWWTFEWYW NQPGVPHVAD       300
     FVTAYKRRFG DKVPTARSWF GYVSAHSIAL AANQAKTLDS LKVVKALEGM ELPPEIALQP       360
     GKVHYRAGDH QMMANMFPGY VPKDASYPNL FKVADVVPSE KIALSPAAAG CKMTYPS          417
//

If you have problems or comments...

PBIL Back to PBIL home page