(data stored in ACNUC7421 zone)

EMBL: CP000690.PE162

CP000690.PE162       Location/Qualifiers
FT   CDS             complement(177004..178908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3462"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; Cl- channel,
FT                   voltage-gated family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3462"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29066"
FT                   /db_xref="GOA:A5FTY4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY4"
FT                   /protein_id="ABQ29066.1"
FT                   /translation="MPFIHRQTPRRIQLGDFTTDRGIFRLIGFGACAGLFGVIAGWILL
FT                   RMIGLINDLAYYGVWSTRMLAPGGAAPGGHPALWTILVPAGGAVAIGLMARYGSEKIRG
FT                   HGIPEAIEAILLGGARLDLRVAILKPISSAISIGTGGPFGAEGPIIMTGGAAASLMAQC
FT                   FTLTDAERKTLLVAGACAGMTAVFGTPVAALLLAVELLLFELKPRSIIPVATACITAAI
FT                   LRRLCMTPAPLFPYAGGVIVDPLHALGWLGLGLAAGLGSALLTVLVYAAEDGFETLPIH
FT                   WMWWPVLGGLVVGIGGVFDPAALGVGYPDIARLLAGTLAGGAAIRLVLVKGVIWSVALG
FT                   SGTSGGVLAPLLIIGGALGAVLAPVMPHAAPGFWAVLGMAAMMGGTMRAPLTSTLFAVE
FT                   LTGNHLILLPVLAASMASMAVTVLLMKRSILTEKIARRGHHLTREYSIDPLAVTRIRDI
FT                   MATKVDTLAADLPVGAAIERFLSHAAAHRAFPVTAPDGLVLGLVSRADILDWIGDEVRR
FT                   DLPLRAMIAGREVTTAAPDEMADTIAVRMLTRNAPRIPVVDAEGRLLGIVSRADLLRVH
FT                   QRVMLAETRRERFFLQGLFSSRKNRIQNVPGMQNAEPQMIPILVNQNGAQNDVDTELR"
     MPFIHRQTPR RIQLGDFTTD RGIFRLIGFG ACAGLFGVIA GWILLRMIGL INDLAYYGVW        60
     STRMLAPGGA APGGHPALWT ILVPAGGAVA IGLMARYGSE KIRGHGIPEA IEAILLGGAR       120
     LDLRVAILKP ISSAISIGTG GPFGAEGPII MTGGAAASLM AQCFTLTDAE RKTLLVAGAC       180
     AGMTAVFGTP VAALLLAVEL LLFELKPRSI IPVATACITA AILRRLCMTP APLFPYAGGV       240
     IVDPLHALGW LGLGLAAGLG SALLTVLVYA AEDGFETLPI HWMWWPVLGG LVVGIGGVFD       300
     PAALGVGYPD IARLLAGTLA GGAAIRLVLV KGVIWSVALG SGTSGGVLAP LLIIGGALGA       360
     VLAPVMPHAA PGFWAVLGMA AMMGGTMRAP LTSTLFAVEL TGNHLILLPV LAASMASMAV       420
     TVLLMKRSIL TEKIARRGHH LTREYSIDPL AVTRIRDIMA TKVDTLAADL PVGAAIERFL       480
     SHAAAHRAFP VTAPDGLVLG LVSRADILDW IGDEVRRDLP LRAMIAGREV TTAAPDEMAD       540
     TIAVRMLTRN APRIPVVDAE GRLLGIVSRA DLLRVHQRVM LAETRRERFF LQGLFSSRKN       600
     RIQNVPGMQN AEPQMIPILV NQNGAQNDVD TELR                                   634
//

If you have problems or comments...

PBIL Back to PBIL home page