(data stored in ACNUC7421 zone)

EMBL: CP000690.PE163

CP000690.PE163       Location/Qualifiers
FT   CDS             complement(180267..181043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29067"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY5"
FT                   /protein_id="ABQ29067.1"
FT                   /translation="MNRACVVADRGMVSADTIAALDALGMEYILGARERTSRVIRDVVL
FT                   KDKAAMVPLVLDRQHGETQLWVKEIRIGKGKAAQRYIVTVNEAEAKKDREDRQAIIDGL
FT                   QAQLKKGDKALVGNSAYRRYLRSRGNAFEIDPGKLAEEARFDGLSVLRTLFRAAKASFD
FT                   TRPVFHQADAAIRGHVFCSFLALTLAKELNRLCGARGFQPEWQKLLNDLDRLQQATIEK
FT                   GGKVITTRTHVTGQVGNVFKAAGIALPHNISEHPAD"
     MNRACVVADR GMVSADTIAA LDALGMEYIL GARERTSRVI RDVVLKDKAA MVPLVLDRQH        60
     GETQLWVKEI RIGKGKAAQR YIVTVNEAEA KKDREDRQAI IDGLQAQLKK GDKALVGNSA       120
     YRRYLRSRGN AFEIDPGKLA EEARFDGLSV LRTLFRAAKA SFDTRPVFHQ ADAAIRGHVF       180
     CSFLALTLAK ELNRLCGARG FQPEWQKLLN DLDRLQQATI EKGGKVITTR THVTGQVGNV       240
     FKAAGIALPH NISEHPAD                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page