(data stored in ACNUC7421 zone)

EMBL: CP000690.PE164

CP000690.PE164       Location/Qualifiers
FT   CDS             complement(181079..181648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3465"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29068"
FT                   /db_xref="GOA:A5FTY6"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY6"
FT                   /protein_id="ABQ29068.1"
FT                   /translation="MSGYRSRSSRFPNVFGRDRAPRWRLLTGAAIAGLLAASAVALAQP
FT                   WGAGWGGGMMGGMGGMMGIGVGLMWQGLYGTPRRDWISSLSPDPFVHPIPMAITAAAGL
FT                   VLLTALICFVVVTVGTLASRPVVASEVTEIPFGNAPVAEDSRWVRLMDRLGLWTLVAFL
FT                   LILAVYGPLFAVLLSHQVSIPPNTAY"
     MSGYRSRSSR FPNVFGRDRA PRWRLLTGAA IAGLLAASAV ALAQPWGAGW GGGMMGGMGG        60
     MMGIGVGLMW QGLYGTPRRD WISSLSPDPF VHPIPMAITA AAGLVLLTAL ICFVVVTVGT       120
     LASRPVVASE VTEIPFGNAP VAEDSRWVRL MDRLGLWTLV AFLLILAVYG PLFAVLLSHQ       180
     VSIPPNTAY                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page