(data stored in ACNUC7421 zone)

EMBL: CP000690.PE166

CP000690.PE166       Location/Qualifiers
FT   CDS             complement(182982..183713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3467"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3467"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29070"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY8"
FT                   /protein_id="ABQ29070.1"
FT                   /translation="MILRQFLHTDPTAASYLLGCVGKGAGVVVDPLFPIEPYLHAASAS
FT                   GSPIHLVIDTHLHADHRSAGRALAEAAGAEYAIHESAEVGYACRRLADGERLEIGNVVL
FT                   EVLHTPGHTPEHLCLTVTDRTRADEPWSVLGGHTLMVGDVGRTELATDAARGARDLFAS
FT                   LVRLKALPDHIEVLPGALAGSVCGRGLSGKPVSTIGFERRHNPAFRIDDAERFVAFMLE
FT                   NIPPAPDGAAELRAWNAGFTA"
     MILRQFLHTD PTAASYLLGC VGKGAGVVVD PLFPIEPYLH AASASGSPIH LVIDTHLHAD        60
     HRSAGRALAE AAGAEYAIHE SAEVGYACRR LADGERLEIG NVVLEVLHTP GHTPEHLCLT       120
     VTDRTRADEP WSVLGGHTLM VGDVGRTELA TDAARGARDL FASLVRLKAL PDHIEVLPGA       180
     LAGSVCGRGL SGKPVSTIGF ERRHNPAFRI DDAERFVAFM LENIPPAPDG AAELRAWNAG       240
     FTA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page