(data stored in ACNUC7421 zone)

EMBL: CP000690.PE167

CP000690.PE167       Location/Qualifiers
FT   CDS             183799..184464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3468"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Rhodanese domain protein; regulatory protein,
FT                   ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3468"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29071"
FT                   /db_xref="GOA:A5FTY9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY9"
FT                   /protein_id="ABQ29071.1"
FT                   /translation="MKSSSGPKQQIFSHLAEIAAALAHPHRIEIIELIAQGERSVEDLA
FT                   ERIGLSLSNTSRHLQVLRRARLAAPRREGKNMFYSLVSETEVVTLLGSLGRVGERNIAE
FT                   IDQVLQAYFRARDCLEPVSRLALLERLRDGSVTLLDVRPADEFARGHLPGALNIPLDQL
FT                   DAALGGFTENVQVVAYCRGPYCVLSYDAVAQLRARGVRAIRLEDGYPEWKAAGLPVET"
     MKSSSGPKQQ IFSHLAEIAA ALAHPHRIEI IELIAQGERS VEDLAERIGL SLSNTSRHLQ        60
     VLRRARLAAP RREGKNMFYS LVSETEVVTL LGSLGRVGER NIAEIDQVLQ AYFRARDCLE       120
     PVSRLALLER LRDGSVTLLD VRPADEFARG HLPGALNIPL DQLDAALGGF TENVQVVAYC       180
     RGPYCVLSYD AVAQLRARGV RAIRLEDGYP EWKAAGLPVE T                           221
//

If you have problems or comments...

PBIL Back to PBIL home page