(data stored in ACNUC7421 zone)

EMBL: CP000690.PE169

CP000690.PE169       Location/Qualifiers
FT   CDS             complement(186235..187143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3470"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3470"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29073"
FT                   /db_xref="GOA:A5FTZ1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTZ1"
FT                   /protein_id="ABQ29073.1"
FT                   /translation="MNESIRTAAISPLRQRLIDDMNMRRFSRETHRNYLRDVGRFATFL
FT                   GRSPDTATAEDLRRFQIEQRDAGVPTPTMNSIVSALRFFFTQTIDRPDLARKLIRTPHP
FT                   RNLPVVLSRDEVARLLNATTCLKHQAALSVAYGAGMRVAEVAALKVSDIDSERMLIRVE
FT                   RGKGGRYRNAILPADLLILLREWWKIGHQQGVMHAQGWLFPGQQVTKPISTRQLHRVVV
FT                   EAARAAEITKRVGPHTLRHSFATHLLEDGVDIRVIQALLGHSHLNTTALYTKVATRTVR
FT                   AVISPLDRLGIVTADQERPAG"
     MNESIRTAAI SPLRQRLIDD MNMRRFSRET HRNYLRDVGR FATFLGRSPD TATAEDLRRF        60
     QIEQRDAGVP TPTMNSIVSA LRFFFTQTID RPDLARKLIR TPHPRNLPVV LSRDEVARLL       120
     NATTCLKHQA ALSVAYGAGM RVAEVAALKV SDIDSERMLI RVERGKGGRY RNAILPADLL       180
     ILLREWWKIG HQQGVMHAQG WLFPGQQVTK PISTRQLHRV VVEAARAAEI TKRVGPHTLR       240
     HSFATHLLED GVDIRVIQAL LGHSHLNTTA LYTKVATRTV RAVISPLDRL GIVTADQERP       300
     AG                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page