(data stored in ACNUC7421 zone)

EMBL: CP000690.PE17

CP000690.PE17        Location/Qualifiers
FT   CDS             22010..23197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3309"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28921"
FT                   /db_xref="GOA:A5FTI9"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI9"
FT                   /protein_id="ABQ28921.1"
FT                   /translation="MDVSGVRNQTGSQTGRAWMGIFSGFCASLVGIGMARFAYTPLLPA
FT                   IIGAHWFQPSAAAYLGAANLAGYLAGALAGRPLATRMTAPSALRTMMFLATSSFFACAY
FT                   PLGFSWFFVWRFCAGLAGGVLMVLAAPTVLPHLPSSRRGLAGGVIFMGVGVGIAASGTF
FT                   VPLLLNQGLQRSWVGLGAISLLLTLASWVGWPAEEIVPRSKPHKIPGTVALRALYVEYA
FT                   LNAVGLVPHMLFLVDFVARGLGNGIRTGAEYWVLFGLGAVVGPILSGHLADRLGFARFL
FT                   RVSYLVEAAAVLLPALGGGAAWLMLSSAVVGAFTPGIVPLVLGRVHELLAHHPAGQNAA
FT                   WSKATVSFATFQAAAAYGLSYIFAQTGDYRQLFIIGAVAMLLAFAIDVLAGGKIQ"
     MDVSGVRNQT GSQTGRAWMG IFSGFCASLV GIGMARFAYT PLLPAIIGAH WFQPSAAAYL        60
     GAANLAGYLA GALAGRPLAT RMTAPSALRT MMFLATSSFF ACAYPLGFSW FFVWRFCAGL       120
     AGGVLMVLAA PTVLPHLPSS RRGLAGGVIF MGVGVGIAAS GTFVPLLLNQ GLQRSWVGLG       180
     AISLLLTLAS WVGWPAEEIV PRSKPHKIPG TVALRALYVE YALNAVGLVP HMLFLVDFVA       240
     RGLGNGIRTG AEYWVLFGLG AVVGPILSGH LADRLGFARF LRVSYLVEAA AVLLPALGGG       300
     AAWLMLSSAV VGAFTPGIVP LVLGRVHELL AHHPAGQNAA WSKATVSFAT FQAAAAYGLS       360
     YIFAQTGDYR QLFIIGAVAM LLAFAIDVLA GGKIQ                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page