(data stored in ACNUC7421 zone)

EMBL: CP000690.PE19

CP000690.PE19        Location/Qualifiers
FT   CDS             complement(24631..25020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28923"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ1"
FT                   /protein_id="ABQ28923.1"
FT                   /translation="MADIWPSVSTSGTSWVRGRRRATSLVCRRADAGCLILYAQDLLGR
FT                   GRAEWYFVEMRHRHLIHEEYTLAAIDDIISRGRWNDWSELRDAARADPKVLERITRVCM
FT                   ANVGDPYAQRYFFWMNYAQEHRSAA"
     MADIWPSVST SGTSWVRGRR RATSLVCRRA DAGCLILYAQ DLLGRGRAEW YFVEMRHRHL        60
     IHEEYTLAAI DDIISRGRWN DWSELRDAAR ADPKVLERIT RVCMANVGDP YAQRYFFWMN       120
     YAQEHRSAA                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page