(data stored in ACNUC7421 zone)

EMBL: CP000690.PE2

CP000690.PE2         Location/Qualifiers
FT   CDS             complement(3287..4855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3293"
FT                   /product="Nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28906"
FT                   /db_xref="GOA:A5FTH4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH4"
FT                   /protein_id="ABQ28906.1"
FT                   /translation="MPRVVSLFLPNWPIDRYNRDRRASAQRPGQPVSGLVDTAPPSPET
FT                   PLILADRDGNRRIVFAANGVAQDLGLRIGMAVAQAQALIPGLTIRDAEPLADVAGLERL
FT                   ALWALHRYAPIVAADPPDGLVIDATGAAHLRGGEAQMLRDMIARLAAAGVTARAAMADS
FT                   WGAAHALARFLANPVFVALADQSRDILLTLPIAALRLPTEMITGLRRLGFERIGDLADQ
FT                   PRAPLALRFGPQLHRRLDQALGTLAEAIEAARSPDLIEVRQNFAEPIGAAETIARYTGI
FT                   LVTELCTMLEAKGLGARQLDLVFHRVDAHSEAIRVGTALPARNAKRLTRLLCDKIETID
FT                   PGFGIEIMALCAARSEPFGPKQLTSLLADEPETDISDLIDTIANRVGGDRLYRFAPVAS
FT                   DVPERSLSRIAATAPPTKMNWPDHWPRPTRLLPNPEPIETVALLPDHPPVNFTWRGIRR
FT                   RVKRADGPERVFGEWWKRDAELIAVRDYFRIEDDAGERFWVFRAGDGEDNATGSHRWFL
FT                   HGIFG"
     MPRVVSLFLP NWPIDRYNRD RRASAQRPGQ PVSGLVDTAP PSPETPLILA DRDGNRRIVF        60
     AANGVAQDLG LRIGMAVAQA QALIPGLTIR DAEPLADVAG LERLALWALH RYAPIVAADP       120
     PDGLVIDATG AAHLRGGEAQ MLRDMIARLA AAGVTARAAM ADSWGAAHAL ARFLANPVFV       180
     ALADQSRDIL LTLPIAALRL PTEMITGLRR LGFERIGDLA DQPRAPLALR FGPQLHRRLD       240
     QALGTLAEAI EAARSPDLIE VRQNFAEPIG AAETIARYTG ILVTELCTML EAKGLGARQL       300
     DLVFHRVDAH SEAIRVGTAL PARNAKRLTR LLCDKIETID PGFGIEIMAL CAARSEPFGP       360
     KQLTSLLADE PETDISDLID TIANRVGGDR LYRFAPVASD VPERSLSRIA ATAPPTKMNW       420
     PDHWPRPTRL LPNPEPIETV ALLPDHPPVN FTWRGIRRRV KRADGPERVF GEWWKRDAEL       480
     IAVRDYFRIE DDAGERFWVF RAGDGEDNAT GSHRWFLHGI FG                          522
//

If you have problems or comments...

PBIL Back to PBIL home page