(data stored in ACNUC7421 zone)

EMBL: CP000690.PE20

CP000690.PE20        Location/Qualifiers
FT   CDS             complement(25326..25595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28924"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ2"
FT                   /protein_id="ABQ28924.1"
FT                   /translation="MSDERPPLSPTEKIRDQLREALAAVNGLELEHSFGKLLDALHEAA
FT                   VNGVQLTEAHNQIIGLIRRRVETTWPETVFGYRGELEAPPDDEV"
     MSDERPPLSP TEKIRDQLRE ALAAVNGLEL EHSFGKLLDA LHEAAVNGVQ LTEAHNQIIG        60
     LIRRRVETTW PETVFGYRGE LEAPPDDEV                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page