(data stored in ACNUC7421 zone)

EMBL: CP000690.PE21

CP000690.PE21        Location/Qualifiers
FT   CDS             25710..26090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28925"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ3"
FT                   /protein_id="ABQ28925.1"
FT                   /translation="MIYSPPARYAGPAIFAGHSMQKSIQTDDIPNIRLQVDTSIATLRK
FT                   LDDLRCRLGLSTYAEVIAAALKHEYAALEARRRLASAPTPPPPSSFSKRAAPEPVVPAA
FT                   PRPQVQARPAPQRVLALGGRER"
     MIYSPPARYA GPAIFAGHSM QKSIQTDDIP NIRLQVDTSI ATLRKLDDLR CRLGLSTYAE        60
     VIAAALKHEY AALEARRRLA SAPTPPPPSS FSKRAAPEPV VPAAPRPQVQ ARPAPQRVLA       120
     LGGRER                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page