(data stored in ACNUC7421 zone)

EMBL: CP000690.PE22

CP000690.PE22        Location/Qualifiers
FT   CDS             26164..28842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3314"
FT                   /product="CRISPR-associated helicase, Cas3 family"
FT                   /note="TIGRFAM: CRISPR-associated helicase Cas3; PFAM:
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28926"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ4"
FT                   /protein_id="ABQ28926.1"
FT                   /translation="MLLPNSWQNVLAFWGKSYTREDKLFAYPIVAHSLDVAAAGSHLPM
FT                   PLKEFDKRTVYFLLSLHDIGKFSRPFQAQESDLWPSRVLGPWPGRVAGPRHDALTAALL
FT                   EVFADEGLLDPVFPLGRRGSGWHPSKRSGLIRTIAGHHGRPIDVPDHLEPAVCRQCLDA
FT                   AREFVQAMLDLFQPSPLPPPQSRRASARMQWQIAGFLTLADWIGSNEIWFPRDGTHSDL
FT                   DPHDYFREVALPRAAQAGADAGLTPSKARTFTGFSALFPKVDTPSPAQSWAETVPLPEG
FT                   AVLAIIEDLTGSGKTEAALTLASRIMASGEAKGIFFALPSMATANSMFQRLTDTYLRLF
FT                   EKGSRPSIALTHGKAGLDPRFRALISASPSSASEPREGEAIPSEAECAAWLAEDRRRSL
FT                   FADVGIGTIDQALLAVLPVRHAPLRLHGLQGKVLVVDEVHAFDSYMDRELQALLEFHAA
FT                   LGGSAILLSATLPLRMRQSLTDAFRRGAGQEAPRQVTSMHYPLATMVGSEAHTEYSLGV
FT                   RAGLPRSVTITRVGTEAEALSRVVDAARLGAAVVWIRNSVDDALEAAAAVRMQNIDPIV
FT                   FHARFAHCDRQSIELEVLRRFGKESVGQARAGVLIATQVVEQSLDLDFDLLVTDLAPVD
FT                   SLIQRAGRLWRHNRGTRVVGRPEMVVLSPEPSMDADAGWLDPLLPRTNNVYRNPALLWR
FT                   GARALFAKSDLVTPGDMRPLIEAADNVADTPPGLKMAADGAWAKHLSHRAFAAGAVLDF
FT                   DEGYTLQSGAWDRETRTPTRLEEREQATLRLARVKDGKVVPYAGLAGDLRQAWTLSEVR
FT                   VQRYRIAACPPPAGYSEAANEARSQWGRWERESPHMLLAILEVTKQEGQLMLKGEKPDG
FT                   HPVSAIYDAVDGLRLLPASAG"
     MLLPNSWQNV LAFWGKSYTR EDKLFAYPIV AHSLDVAAAG SHLPMPLKEF DKRTVYFLLS        60
     LHDIGKFSRP FQAQESDLWP SRVLGPWPGR VAGPRHDALT AALLEVFADE GLLDPVFPLG       120
     RRGSGWHPSK RSGLIRTIAG HHGRPIDVPD HLEPAVCRQC LDAAREFVQA MLDLFQPSPL       180
     PPPQSRRASA RMQWQIAGFL TLADWIGSNE IWFPRDGTHS DLDPHDYFRE VALPRAAQAG       240
     ADAGLTPSKA RTFTGFSALF PKVDTPSPAQ SWAETVPLPE GAVLAIIEDL TGSGKTEAAL       300
     TLASRIMASG EAKGIFFALP SMATANSMFQ RLTDTYLRLF EKGSRPSIAL THGKAGLDPR       360
     FRALISASPS SASEPREGEA IPSEAECAAW LAEDRRRSLF ADVGIGTIDQ ALLAVLPVRH       420
     APLRLHGLQG KVLVVDEVHA FDSYMDRELQ ALLEFHAALG GSAILLSATL PLRMRQSLTD       480
     AFRRGAGQEA PRQVTSMHYP LATMVGSEAH TEYSLGVRAG LPRSVTITRV GTEAEALSRV       540
     VDAARLGAAV VWIRNSVDDA LEAAAAVRMQ NIDPIVFHAR FAHCDRQSIE LEVLRRFGKE       600
     SVGQARAGVL IATQVVEQSL DLDFDLLVTD LAPVDSLIQR AGRLWRHNRG TRVVGRPEMV       660
     VLSPEPSMDA DAGWLDPLLP RTNNVYRNPA LLWRGARALF AKSDLVTPGD MRPLIEAADN       720
     VADTPPGLKM AADGAWAKHL SHRAFAAGAV LDFDEGYTLQ SGAWDRETRT PTRLEEREQA       780
     TLRLARVKDG KVVPYAGLAG DLRQAWTLSE VRVQRYRIAA CPPPAGYSEA ANEARSQWGR       840
     WERESPHMLL AILEVTKQEG QLMLKGEKPD GHPVSAIYDA VDGLRLLPAS AG               892
//

If you have problems or comments...

PBIL Back to PBIL home page