(data stored in ACNUC7421 zone)

EMBL: CP000690.PE23

CP000690.PE23        Location/Qualifiers
FT   CDS             29133..30722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3315"
FT                   /product="CRISPR-associated protein, Cse1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28927"
FT                   /db_xref="InterPro:IPR013381"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ5"
FT                   /protein_id="ABQ28927.1"
FT                   /translation="MFNLLTNPWLPIVRQDGTKSVIAPRGITEDISANPVIAVDWPRAD
FT                   FRLATMELLAGLIATACPPADEDDWLDAWEAPPSPEKLDGALAPLSHAFSFDGPGPRFM
FT                   QDLADLDADEEPVENLLIEVAGNSGPLVHPGRTKRMGRPAAAISLYTLQSWSPSGGRGN
FT                   RTGLRGGGPMVTMVAPGRHRSLWHHIWANVPLGRKPEPVDFPRIFPWLSPTITSVNDEV
FT                   VTPDDVAHPLQVWWGMPRRIRLSFVQLPSPAPCDLTGALDSSVVTGWRQRPHGPQYVGW
FT                   GTRHPLTPTYQNKAGEEILSVHPNPGGVGYRNWIGLVLRSPDGLRRPAPIVSTWRNDRY
FT                   RGTEEAKGARLIAGGYDTDNMKARGFMETEVPLVLASSKEVQERLDALATSLVRASERA
FT                   SYQLRKAVQQALYHPGAKVKATAHGIALLGDRVWLETESAFFSALHRAMSLDDTAPERV
FT                   AWQARLRGLALRIFDDTVPIDPLDRNNVRQVRARFFLGLGLSGYGKDGQSFFQILEMPL
FT                   PAQEKKSKGKAS"
     MFNLLTNPWL PIVRQDGTKS VIAPRGITED ISANPVIAVD WPRADFRLAT MELLAGLIAT        60
     ACPPADEDDW LDAWEAPPSP EKLDGALAPL SHAFSFDGPG PRFMQDLADL DADEEPVENL       120
     LIEVAGNSGP LVHPGRTKRM GRPAAAISLY TLQSWSPSGG RGNRTGLRGG GPMVTMVAPG       180
     RHRSLWHHIW ANVPLGRKPE PVDFPRIFPW LSPTITSVND EVVTPDDVAH PLQVWWGMPR       240
     RIRLSFVQLP SPAPCDLTGA LDSSVVTGWR QRPHGPQYVG WGTRHPLTPT YQNKAGEEIL       300
     SVHPNPGGVG YRNWIGLVLR SPDGLRRPAP IVSTWRNDRY RGTEEAKGAR LIAGGYDTDN       360
     MKARGFMETE VPLVLASSKE VQERLDALAT SLVRASERAS YQLRKAVQQA LYHPGAKVKA       420
     TAHGIALLGD RVWLETESAF FSALHRAMSL DDTAPERVAW QARLRGLALR IFDDTVPIDP       480
     LDRNNVRQVR ARFFLGLGLS GYGKDGQSFF QILEMPLPAQ EKKSKGKAS                   529
//

If you have problems or comments...

PBIL Back to PBIL home page