(data stored in ACNUC7421 zone)

EMBL: CP000690.PE24

CP000690.PE24        Location/Qualifiers
FT   CDS             30719..31258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3316"
FT                   /product="CRISPR-associated protein, Cse2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28928"
FT                   /db_xref="InterPro:IPR013382"
FT                   /db_xref="InterPro:IPR038287"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ6"
FT                   /protein_id="ABQ28928.1"
FT                   /translation="MIRYRSAAHDWWRDLVPRAGYPGDRAAVAKLRRASTISEAITEEA
FT                   SIALFRRVGATSAEDLPRVALAAAILARVSKEPDGPNAPRSVARVLGPQKTDDVSTAIL
FT                   SPLRFKRLLAVDEPEEQLIAFRRMVAIARGSLPVRDLADALLDWSETRRRRWVFDYWNA
FT                   SEIASTPTTDTPEEPV"
     MIRYRSAAHD WWRDLVPRAG YPGDRAAVAK LRRASTISEA ITEEASIALF RRVGATSAED        60
     LPRVALAAAI LARVSKEPDG PNAPRSVARV LGPQKTDDVS TAILSPLRFK RLLAVDEPEE       120
     QLIAFRRMVA IARGSLPVRD LADALLDWSE TRRRRWVFDY WNASEIASTP TTDTPEEPV        179
//

If you have problems or comments...

PBIL Back to PBIL home page