(data stored in ACNUC7421 zone)

EMBL: CP000690.PE25

CP000690.PE25        Location/Qualifiers
FT   CDS             31258..32370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3317"
FT                   /product="CRISPR-associated protein, Cse4 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28929"
FT                   /db_xref="InterPro:IPR010148"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ7"
FT                   /protein_id="ABQ28929.1"
FT                   /translation="MTQFLQVHLLTFFPPSNMNRDDTGRPKTAMVGGAMRLRLSSQALK
FT                   RAWRTSTIFSEALKGYMGERTQRLGEEILKTLQAEGVSEVQALAVARAVAGQFGKLNED
FT                   ETPARIQQLAFISPDERKAAFDLARRYAAGELPLPEKAKGKRGKANKTEGEEEVEAPEI
FT                   LLLRESDTAADIALFGRMLADKPAFNREAAAQVAHAITTHRISVDDDYYTAVDDLKRPS
FT                   EDAGAGFIGETGFGSGVFYTYMSINIDLLIRNLGGGDQARDLAATAIAALVEAAATTAP
FT                   SGKQNSFAAHGRAGYILAERGKAQPRTLAGAFAKPVEGGDIMDASIGRLEEFREAIDKA
FT                   YGPTADATKVMRVGGEGSLADIIVFAREGV"
     MTQFLQVHLL TFFPPSNMNR DDTGRPKTAM VGGAMRLRLS SQALKRAWRT STIFSEALKG        60
     YMGERTQRLG EEILKTLQAE GVSEVQALAV ARAVAGQFGK LNEDETPARI QQLAFISPDE       120
     RKAAFDLARR YAAGELPLPE KAKGKRGKAN KTEGEEEVEA PEILLLRESD TAADIALFGR       180
     MLADKPAFNR EAAAQVAHAI TTHRISVDDD YYTAVDDLKR PSEDAGAGFI GETGFGSGVF       240
     YTYMSINIDL LIRNLGGGDQ ARDLAATAIA ALVEAAATTA PSGKQNSFAA HGRAGYILAE       300
     RGKAQPRTLA GAFAKPVEGG DIMDASIGRL EEFREAIDKA YGPTADATKV MRVGGEGSLA       360
     DIIVFAREGV                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page