(data stored in ACNUC7421 zone)

EMBL: CP000690.PE26

CP000690.PE26        Location/Qualifiers
FT   CDS             32372..33121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3318"
FT                   /product="CRISPR-associated protein, Cas5e family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas5 family;
FT                   CRISPR-associated protein Cas5"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28930"
FT                   /db_xref="GOA:A5FTJ8"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ8"
FT                   /protein_id="ABQ28930.1"
FT                   /translation="MKRFLTFTLFAPIASFGAIAVGERRESWSRPARSAVLGLVGACLG
FT                   IEREDAEEQAALERDFGFALLCGTSGGPLADFHTLQVGRPARGQTFRTRAEELNSNTVD
FT                   TILTRRDYRVSAWHLAALWVRSVVDPRWALEDLADAMKQPAFTPYLGRRACPLGLPLAP
FT                   QIIDADSPASALDRRWASGPEAEFRPSLAGTIQDLFVARDRWVGDEGANNLLRSEERRD
FT                   APISRTLWQFGLRTEVIEAFSPTENRS"
     MKRFLTFTLF APIASFGAIA VGERRESWSR PARSAVLGLV GACLGIERED AEEQAALERD        60
     FGFALLCGTS GGPLADFHTL QVGRPARGQT FRTRAEELNS NTVDTILTRR DYRVSAWHLA       120
     ALWVRSVVDP RWALEDLADA MKQPAFTPYL GRRACPLGLP LAPQIIDADS PASALDRRWA       180
     SGPEAEFRPS LAGTIQDLFV ARDRWVGDEG ANNLLRSEER RDAPISRTLW QFGLRTEVIE       240
     AFSPTENRS                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page