(data stored in ACNUC7421 zone)

EMBL: CP000690.PE27

CP000690.PE27        Location/Qualifiers
FT   CDS             33127..33804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3319"
FT                   /product="CRISPR-associated protein, Cse3 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse3 family;
FT                   PFAM: CRISPR-associated protein, CT1974"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28931"
FT                   /db_xref="InterPro:IPR010179"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ9"
FT                   /protein_id="ABQ28931.1"
FT                   /translation="MWLSKARLNHDQKAVAALASVLVPEDGSARVAATHHLVWSLFAGD
FT                   ADRKRDFLWREERPGHFLILSPDRPGDGGGLCTVESKEFTPALSAGDRLGFSLRANAVV
FT                   SRGEPGSGRGKRHDVVMDVLRHHPKGERASHRLGLVTEAGAAWLVRQGERHGFVIEGQP
FT                   ACDGYEAIRVLRGRGEKPLTFSQIDFAGVLSVTDPARFIAAIGHGFGRARAFGCGLMLI
FT                   RRV"
     MWLSKARLNH DQKAVAALAS VLVPEDGSAR VAATHHLVWS LFAGDADRKR DFLWREERPG        60
     HFLILSPDRP GDGGGLCTVE SKEFTPALSA GDRLGFSLRA NAVVSRGEPG SGRGKRHDVV       120
     MDVLRHHPKG ERASHRLGLV TEAGAAWLVR QGERHGFVIE GQPACDGYEA IRVLRGRGEK       180
     PLTFSQIDFA GVLSVTDPAR FIAAIGHGFG RARAFGCGLM LIRRV                       225
//

If you have problems or comments...

PBIL Back to PBIL home page